PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P26000_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 369aa    MW: 40671.3 Da    PI: 5.5718
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P26000_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.83.3e-073113432254
                            SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             +yp+++++++L +++gL+ +q+ +WF N+R +
  GSMUA_Achr1P26000_001 311 WPYPTEDDKARLVEETGLQLKQINNWFINQRKR 343
                            58*****************************87 PP

2ELK27.95.5e-10264285122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+L+++Y+ +++++++E++
  GSMUA_Achr1P26000_001 264 ELKHELKQGYKNKIVDIREEIL 285
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-1894138IPR005540KNOX1
PfamPF037909.7E-1796137IPR005540KNOX1
SMARTSM012561.5E-28149204IPR005541KNOX2
PfamPF037918.7E-21153203IPR005541KNOX2
SMARTSM011888.5E-4264285IPR005539ELK domain
PfamPF037899.1E-6264285IPR005539ELK domain
PROSITE profilePS5121310.022264284IPR005539ELK domain
PROSITE profilePS5007111.24284347IPR001356Homeobox domain
SMARTSM003891.8E-10286351IPR001356Homeobox domain
SuperFamilySSF466894.08E-16286353IPR009057Homeodomain-like
CDDcd000869.09E-12287348No hitNo description
Gene3DG3DSA:1.10.10.602.6E-24291348IPR009057Homeodomain-like
PfamPF059202.5E-17304343IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MAGGGGPTWL NSAILRQQGH HYADRSFLHL QTTSGSSASP DEVPVSNDPI MAGATSGEHG  60
GRRGHAGGEL GESEAVAQGS GGETAAGEVT WMNARYKAEI LAHPLCEQLL AAHVACLRIA  120
TPVDQLPRID AQLGQSQQIV SKYSVLGNNG QMPGDDKELD QFMTHYVLLL CSFKEQLQQH  180
VRVHAMEAVM ACWELEQSLQ SLTGVSPGEG TGATMSDDDD DDGDDDDDQV DSETNLFDGP  240
DSMGFGPLIP TETERSLMER VRQELKHELK QGYKNKIVDI REEILRKRRA GKLPGNSTCT  300
LKAWWQSHSK WPYPTEDDKA RLVEETGLQL KQINNWFINQ RKRNWHSNPS SSSSSSLKSK  360
RKRFAMCTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-13287351872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1340362RKRNWHSNPSSSSSSSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418154.10.0PREDICTED: homeobox protein knotted-1-like 13 isoform X1
SwissprotP480001e-168KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM0S3570.0M0S357_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P26000_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-161KNOTTED1-like homeobox gene 3